AnaSpec Introduces Sixteen New Catalog Peptides

PRLog (Press Release) – Dec 18, 2007 – This week AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced sixteen (16) new catalog peptides.

[Cys17]-beta-Amyloid (1-17)- Cat# 62473
This peptide amino acids 1 to 17 is a modified fragment of the b-amyloid peptide; with cysteine substituted for valine at position 17.
Sequence: DAEFRHDSGYEVHHQKLC

[Cys24]-beta-Amyloid (1-24)- Cat# 62475
This peptide with amino acids 1 to 24 is a modified fragment of the b-amyloid peptide; with cysteine substitution for valine at position 24.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDC

Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2- Cat# 62136
This is the N-terminal fragment of the b-amyloid peptide; residues 1 to 17; biotinylated on the lysine side chain with 6-aminohexanoate (LC) as a spacer .
Sequence: DAEFRHDSGYEVHHQKK(Biotin-LC)-NH2

Beta-Amyloid (1-16)-Lys(LC-Biotin)-NH2- Cat# 62464
This is amino acids 1 to 17 N-terminal fragment of the b-amyloid peptide with 6-aminohexanoate (LC) as a spacer on the side chain of lysine; and biotinylated
Sequence: DAEFRHDSGYEVHHQKK(LC-BIOTIN)-NH2

Beta-Amyloid (1-28)-Lys (Biotin)- Cat# 62465
This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKK(Biotin)-NH2

Beta-Amyloid (22-40)- Cat# 62453
This is amino acids 22 to 40 fragment of the ß-?amyloid peptide. This sequence may be used in the ß-?amyloid structure and aggregation studies.
Sequence: EDVGSNKGAIIGLMVGGVV

Beta-Amyloid (25-35); biotinylated- Cat# 62451
This peptide is amino acids 25 to 35 fragment of the ß-amyloid; biotinylated at C-terminus. This peptide possesses many of the characteristics of the full-length ß-amyloid peptide; including an amphiphilic nature and an ability to aggregate; and can serve as a model system to study the conformational changes involved in Alzheimer's disease. Aggregates of ß-amyloid (25–35) have been shown to possess the neurotrophic and neurotoxic properties of their full-length counterparts and there is evidence that the monomeric form of the peptide may itself be cytotoxic.
Sequence: Biotin-GSNKGAIIGLM

Galanin Like Peptide (GALP); rat- Cat# 61847-05
This 60-amino acid rat Galanin Like Peptide (GALP) has homology with human and porcine GALP. GALP peptide was first isolated from the porcine hypothalamus; and then identified in other species including rats and humans. It shows GALR2-agonistic activity; and induces food intake. Studies show the importance of hypothalamic GALP in the integration of metabolism and reproduction.
Sequence: APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

RAB38/NY-MEL-1 (50-58)- Cat# 62367
This is amino acids 50 to 58 fragment of the melanocyte differentiation antigen RAB38/NY-MEL-1 protein which is expressed in the vast majority of melanoma lesions. The immunogenicity of RAB38/NY-MEL-1 has been corroborated by the frequent occurrence of specific antibody responses in melanoma patients. This peptide exhibits a marked response in ELISPOT assays after in vitro sensitization of CD8 T cells from HLA-A*0201+ melanoma patients.
Sequence: VLHWDPETV

PB2 (198–206) Polymerase Mimotope- Cat# 62259
This peptide is derived from the PB2 polymerase (PB2198–206). PB2198 is a mimotope that can stimulate an IFN-gamma. response by highly activated PB1703-specific CD8+ T cells and is recognized by PB1703-specific CTL. It is not capable of driving either the clonal expansion of cells that bind the KbPB1703- tetramer or effector CTL generation following in vitro culture.
Sequence: ISPLMVAYM

Measles Virus Fusion Protein (421–435)- Cat# 62409
This peptide is amino acid 421 to 435 fragment of the measles virus fusion protein (MV-F). It is an immunodominant Ta; H2d restricted epitope; it induces MV-specific T lymphocytes in vivo.
Sequence: PVVEVNGVTIQVGSR

[pTyr429] Erythropoietin Receptor Peptide (EpoR); (423-438)- Cat# 62345
This is amino acid 423 to 438 fragment of the Erythropoietin Receptor Peptide (EpoR); phosphorylated at Tyr429. It binds to the N-SH2 domain that has a function in regulation of the PTPase domain and thereby signal transduction. It activates SHP-1 (previously called PTP1C; HCP; and SHPTP1); a protein-tyrosine phosphatase with two Src homology 2 (SH2) domains predominantly expressed in hematopoietic cells.
Sequence: DPPHLK-pY-LYLVVSDSK

MAGE-A1 Antigen (278-286); human- Cat# 62365
This peptide is amino acids 278 to 286 fragment of MAGE protein. It was found to be presented by HLA-A 0201 molecules on the surface of a human breast carcinoma cell line. MAGE-A1 tumor antigen can fully activate the mouse peptide-specific CTL lines to produce IFN-gamma. Tumor-specific shared antigens; such as those of the MAGE gene family; are expressed by tumors of different histological types.
Sequence: KVLEYVIKV

p53 (17-26)- Cat# 61375
This peptide is amino acids 17 to 26 fragment of p53; the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence: ETFSDLWKLL

Myelopeptide-1 (MP-1)- Cat# 62362
This immunoregulatory peptide was originally isolated from the conditioned medium of porcine bone marrow cell cultures. Myelopeptide-1 blocks the T-suppressor activity. It enhances the number of antibody-forming cells in mouse spleen cells in vitro and increases antibody production in (CBAxC57B1/6)F1 mice in vivo.
Sequence: FLGFPT

Insulin Growth Factor Binding Protein 6 (IGFBP6); human- Cat# 62417
This decapeptide belongs to the human insulin growth factor (IGF) binding protein 6 (IGFBP6). There are six well-characterized IGFBPs. They are not only carriers of IGFs; but also modulators of their activity. IGFBPs are important in cell growth.
Sequence: APAVAEENPK

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

For more information visit www.anaspec.com