Bak BH3 (71-89)- Cat# 62261
This peptide is amino acids 71 to 89 fragment of the Bak BH3 domain .The BH3 domain plays a critical role in mediating the cell death and protein-binding functions of Bak. It is a pro-apoptotic protein. Bak BH3 peptides trigger the rapid activation of caspases. Pharmacological inhibition of caspases prevents BH3-induced apoptosis.
Sequence: MGQVGRQLAIIGDDINRRY
Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide- Cat# 62262
This is a fusion peptide containing amino acids 71 to 89 fragment of the Bak BH3 domain fused to antennapedia peptide. The Bcl-2 homology 3 (BH3) domain is crucial for the death-inducing and dimerization properties of pro-apoptotic members of the Bcl-2 protein family; including Bak; Bax; and Bad. Synthetic peptides corresponding to the BH3 domain of Bak bind to Bcl-xL; antagonize its anti-apoptotic function; and rapidly induce apoptosis when delivered into intact cells via fusion to the antennapedia homeoprotein internalization domain.
Sequence: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
Bim BH3 Fragment I; TAMRA labeled- Cat# 62264
This peptide belongs to the Bim family; a subgroup of pro-apoptotic proteins that resemble other Bcl-2 family members within the short BH3 domain only. Pro-apoptotic Bcl-2 activates cell death by neutralizing the anti-apoptotic proteins; which in turn maintain cell viability by regulating the activation of caspases. This peptide is labeled with TAMRA at the N-terminus.
Sequence: 5-TAMRA-DNRPEIWIAQELRRIGDEFNAYYAR
Bim BH3; Fragment II; TAMRA labeled- Cat# 62265
This synthetic peptide is derived from the BH3 domain of Bim that reportedly functions as direct 'death agonist' of Bax. Bim belongs to a distinct subgroup of proapoptotic proteins that resemble other Bcl-2 family members within this BH3 domain. This peptide is labeled with 5-TAMRA at the N-terminus.
Sequence: 5-TAMRA-MRPEIWIAQELRRIGDEFNA
BAK-BH3 (69-93)- Cat# 62272
This peptide belongs to the functional domain of BAK; the member of the Bcl-2 family. Bak promotes apoptosis and binds anti-apoptotic family members including Bcl-2 and Bcl-xL. This domain in Bakt is necessary and sufficient for cytotoxic activity and binding to Bcl-xL. It is capable of modulating apoptosis in cells.
Sequence: STMGQVGRQLAIIGDDINRRYDSEF
Bcl-2 BH3 Peptide II- Cat# 62273
This synthetic peptide is derived from the BH3 domain; member of the Bcl-2 family.
Sequence: LSPVPPVVHLALRQAGDDFSRRYRG
Bcl9-2; mutant- Cat# 62275
This peptide is a mutant form of the Bcl9-2 peptide with the single substitution of Leu to Phe. Beta-catenin-
Sequence: GSEGLSKEQLEHRERSFQTLRDIERLLLRSGETEPFLKGPPGGAG-
Bid BH3 (77-100); mouse- Cat# 62317
This peptide is amino acids 77 to 100 fragment of the murine Bid BH3. The BH3 domain of Bid is believed to play an essential role in Bax activation.
Sequence: ESQEEIIHNIARHLAQIGDEMDHN
Bid BH3; Peptide II; TAMRA labeled- Cat# 62277
This sequence belongs to the Bid peptide; a pro-apoptotic member of the 'BH3-only' subset of the BCL-2 family of proteins; the essential regulators of apoptosis. This peptide is labeled with TAMRA.
Sequence: 5-TAMRA-EDIIRNIARHLAQVGDSMDR
Bim BH3; Peptide IV- Cat# 62279
This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence: DMRPEIWIAQELRRIGDEFNAYYARR
Bim BH3; Peptide III- Cat# 62278
This Bim peptide belongs to the pro-apoptotic Bcl-2 family of proteins.
Sequence: DMRPEIWIAQELRRIGDEFNAYYAR
Bax I- Cat# 62268
This pro-apoptotic peptide belongs to the Bax group of the Bcl-2 family; the key regulators of apoptosis.
Sequence: PQDASTKKLSECLKRIGDELDSNMEL
a2b1 Integrin Ligand Peptide- Cat# 60909-25
Sequence: DEGA
Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies:
For more information visit www.anaspec.com
