Influenza Matrix Protein (62-70); MP (62-70)- Cat# 62288
This peptide is a fragment of the influenza virus matrix protein amino acid residues 62 to 70. It contains the core sequence of a new major histocompatibility complex class II-restricted T-cell epitope of influenza virus matrix protein. This epitope was detected in the peripheral blood of influenza A patients.
Sequence: GFVFTLTVPSER
HA 12CA5 Epitope- Cat# 62229
This 10-amino acid peptide epitope tag from hemophilus influenza is recognized by the common monoclonal antibody 12Ca5.
Sequence: CYPYDVPDYA
Cortistatin-
Cortistatin (CST) a cyclic neuropeptide;
Sequence: EGAPPQQSARRDRMPCRNFFWKTFSSCK (Disulfide bridge:16-27)
[Cys1] Inter-alpha-
This peptide is a proteolytically derived C-terminal fragment from the proline-rich region (PRR) of human inter-alpha-
Sequence: CLGLPGPPDVPDH.
[Cys1] Inter-alpha-
This peptide is a C-terminal fragment of the alpha -trypsin inhibitor heavy chain 4(ITIH4). Several proteolytically derived fragments from the proline-rich region (PRR) of human ITIH4 have been identified and these fragmentation patterns are associated with different disease conditions and may hold important diagnostic information. These fragmentation patterns could be useful as potential biomarkers for detection and classification of cancer. Cys is added to the sequence for use as an antigen for antibody production.
Sequence: CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF
RSK3; Ribosomal S6 Kinase 3- Cat# 62079
This peptide belongs to the family of protein kinases that mediate signal transduction downstream of MAP kinase cascades. RSK is activated by MAP kinases of the extracellular signal-regulated kinase (ERK) family in response to growth factors; polypeptide hormones; neurotransmitters;
Sequence: ALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
MK2a (370-400); Mitogen-activated Protein Kinase-activated Protein Kinase 2a- Cat# 62153
This peptide represents protein kinase downstream of p38 mitogen-activated protein kinase (MAPK). The p38 signaling pathway is activated in response to cell stress or mitogens. P38 is phosphorylated and activated; and in turn phosphorylates a number of substrates; including this MAPKAP kinase 2 (MK2). The mk2 gene encodes two alternatively spliced transcripts of 370 amino acids (MK2a) and 400 amino acids (MK2b). P38 alpha forms a complex with MK2a. Specific interactions between the carboxy-terminal residues of MK2a (370-400) and p38alpha precipitate formation of this high-affinity complex.
Sequence: IKIKKIEDASNPLLLKRRKKARALEAAALAH
MBP (63–81); Myelin Basic Protein (63–81)- Cat# 62082
This peptide; with amino acids 63 to 79; is a fragment of the myelin basic protein and is the dominant encephalitogenic peptide for DA rats. Rats develop experimental autoimmune encephalomyelitis (EAE) after the immunization with this peptide. This sequence was also used in the research attempts to prevent EAE with neutralizing antibodies to IFN-gamma-Inducing Factor.
Sequence: ARTTHYGSLPQKSQRSQ
VEGFR-2/KDR II; murine- Cat# 62091
This peptide is a naturally processed CD8 T-cell epitope; the murine vascular endothelial growth factor receptor 2(VEGFR-2)/KDR fragment II; that binds murine MHC Class I molecules and elicits an anti-angiogenic immune response. VEGFR2/KDR plays a crucial role in tumor-associated angiogenesis and vascularization. Immunization with this peptide effectively reduces angiogenesis and inhibits tumor growth in mouse models.
Sequence: VILTNPISM
[Glu63] Bax BH3; mutant- Cat# 62267
This 20–amino acid Bax BH3 peptide (Bax 1) contains a point mutation L63E in the first lysine residue of the BH3 domain (Bax-M1). L63E mutation does not affect the native conformation of either Bax-alpha or Bax-
Sequence: STKKLSECEKRIGDELDSNM
Bax BH3 peptide (55-74); wild type- Cat# 62266
This is a 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models. In addition to disrupting Bax/Bcl-2 and Bax/Bcl-XL; it can promote cytochrome c release from isolated mitochondria. Bax BH3 belongs to the Bcl-2 protein family which consists of both pro-apoptotic and anti-apoptotic members. Bax BH3 acts to regulate apoptosis via governance of the 'intrinsic' pathway of cell death.
Sequence: STKKLSECLKRIGDELDSNM
BMf-BH3- Cat# 62281
This peptide belongs to the Bcl-2 family of apoptosis mediators. Bmf is a key molecule for histone deacetylase (HDAC) inhibitors which alters the balance between acetylation and deacetylation;
Sequence: LQHRAEVQIARKLQCIADQFHRLHT
GRP78 Binding Chimeric Peptide Motif- Cat# 62205
This peptide is a synthetic chimeric peptide composed of GRP78 binding motif fused to a programmed cell death-inducing sequence. This chimeric peptide can suppress tumor growth in xenograft and isogenic mouse models of prostate and breast cancer.
Sequence: WIFPWIQL-GG-
Bcl 9-2- Cat# 62274
Bcl 9-2 is an essential nuclear co-activator of beta-catenin signaling. This Bcl 9-2 peptide promotes beta-catenin's transcriptional activity that is enhanced by tyrosine phosphorylation. Beta-catenin-
Sequence: GSEGLSKEQLEHRERSLQTLRDIERLLLRSGETEPFLKGPPGGAG-
Glucosyltransferase I (442-462); streptococcus mutans- Cat# 62107
This peptide was derived from the sequence in the catalytic (CAT) region of streptococcus mutans glucosyltransferases (GTFs). This peptide may have value for inclusion in a synthetic dental caries vaccine because GTFs have been implicated as important constituents in the active accumulation of streptococci on teeth.
Sequence: DANFDSIRVDAVDNVDADLLQ
Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies:
